NEURL polyclonal antibody
  • NEURL polyclonal antibody

NEURL polyclonal antibody

Ref: AB-PAB24309
NEURL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NEURL.
Información adicional
Size 100 uL
Gene Name NEURL
Gene Alias NEURL1|RNF67|h-neu|neu-1
Gene Description neuralized homolog (Drosophila)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NEURL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9148
Iso type IgG

Enviar un mensaje


NEURL polyclonal antibody

NEURL polyclonal antibody