RNASE12 polyclonal antibody
  • RNASE12 polyclonal antibody

RNASE12 polyclonal antibody

Ref: AB-PAB24305
RNASE12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNASE12.
Información adicional
Size 100 uL
Gene Name RNASE12
Gene Alias -
Gene Description ribonuclease, RNase A family, 12 (non-active)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq INGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACRYHYSPTEGFVLVTCDDLRPDSFLGYV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNASE12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 493901
Iso type IgG

Enviar un mensaje


RNASE12 polyclonal antibody

RNASE12 polyclonal antibody