CDC26 polyclonal antibody
  • CDC26 polyclonal antibody

CDC26 polyclonal antibody

Ref: AB-PAB24297
CDC26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDC26.
Información adicional
Size 100 uL
Gene Name CDC26
Gene Alias C9orf17
Gene Description cell division cycle 26 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDC26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 246184
Iso type IgG

Enviar un mensaje


CDC26 polyclonal antibody

CDC26 polyclonal antibody