CC2D2A polyclonal antibody
  • CC2D2A polyclonal antibody

CC2D2A polyclonal antibody

Ref: AB-PAB24295
CC2D2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CC2D2A.
Información adicional
Size 100 uL
Gene Name CC2D2A
Gene Alias JBTS9|KIAA1345|MKS6
Gene Description coiled-coil and C2 domain containing 2A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLLAEVFLPIPETTVVTGRAPTEEVEFSSN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CC2D2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57545
Iso type IgG

Enviar un mensaje


CC2D2A polyclonal antibody

CC2D2A polyclonal antibody