ZNF564 polyclonal antibody
  • ZNF564 polyclonal antibody

ZNF564 polyclonal antibody

Ref: AB-PAB24286
ZNF564 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF564.
Información adicional
Size 100 uL
Gene Name ZNF564
Gene Alias FLJ38281|MGC26914
Gene Description zinc finger protein 564
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FQRHERAHNGDKPYVKNVGKLSFITQPSNTCE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF564.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163050
Iso type IgG

Enviar un mensaje


ZNF564 polyclonal antibody

ZNF564 polyclonal antibody