RHBDD3 polyclonal antibody
  • RHBDD3 polyclonal antibody

RHBDD3 polyclonal antibody

Ref: AB-PAB24282
RHBDD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RHBDD3.
Información adicional
Size 100 uL
Gene Name RHBDD3
Gene Alias C22orf3|HS984G1A|PTAG
Gene Description rhomboid domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RHBDD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25807
Iso type IgG

Enviar un mensaje


RHBDD3 polyclonal antibody

RHBDD3 polyclonal antibody