C12orf60 polyclonal antibody
  • C12orf60 polyclonal antibody

C12orf60 polyclonal antibody

Ref: AB-PAB24277
C12orf60 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf60.
Información adicional
Size 100 uL
Gene Name C12orf60
Gene Alias MGC47869
Gene Description chromosome 12 open reading frame 60
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSKTTMIDTLKKLQDVLKTEDSKNPTKSAADLLEQIVKAMGPILEILQKAIKTMEMNISVFKKASD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf60.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 144608
Iso type IgG

Enviar un mensaje


C12orf60 polyclonal antibody

C12orf60 polyclonal antibody