FAM113B polyclonal antibody
  • FAM113B polyclonal antibody

FAM113B polyclonal antibody

Ref: AB-PAB24276
FAM113B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM113B.
Información adicional
Size 100 uL
Gene Name FAM113B
Gene Alias MGC16044
Gene Description family with sequence similarity 113, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFDVLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM113B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91523
Iso type IgG

Enviar un mensaje


FAM113B polyclonal antibody

FAM113B polyclonal antibody