SLC38A9 polyclonal antibody
  • SLC38A9 polyclonal antibody

SLC38A9 polyclonal antibody

Ref: AB-PAB24268
SLC38A9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC38A9.
Información adicional
Size 100 uL
Gene Name SLC38A9
Gene Alias FLJ46104|FLJ90709|MGC120544
Gene Description solute carrier family 38, member 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAY
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC38A9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 153129
Iso type IgG

Enviar un mensaje


SLC38A9 polyclonal antibody

SLC38A9 polyclonal antibody