KCTD14 polyclonal antibody
  • KCTD14 polyclonal antibody

KCTD14 polyclonal antibody

Ref: AB-PAB24192
KCTD14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCTD14.
Información adicional
Size 100 uL
Gene Name KCTD14
Gene Alias MGC2376
Gene Description potassium channel tetramerisation domain containing 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WQGCAVERPVGRMTSQTPLPQSPRPRRPTMSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDAEGRFFIDR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCTD14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65987
Iso type IgG

Enviar un mensaje


KCTD14 polyclonal antibody

KCTD14 polyclonal antibody