RPL13A polyclonal antibody
  • RPL13A polyclonal antibody

RPL13A polyclonal antibody

Ref: AB-PAB24130
RPL13A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPL13A.
Información adicional
Size 100 uL
Gene Name RPL13A
Gene Alias -
Gene Description ribosomal protein L13a
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPL13A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23521
Iso type IgG

Enviar un mensaje


RPL13A polyclonal antibody

RPL13A polyclonal antibody