IFT172 polyclonal antibody
  • IFT172 polyclonal antibody

IFT172 polyclonal antibody

Ref: AB-PAB24092
IFT172 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IFT172.
Información adicional
Size 100 uL
Gene Name IFT172
Gene Alias DKFZp434A163|KIAA1179|SLB|osm-1|wim
Gene Description intraflagellar transport 172 homolog (Chlamydomonas)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SSPGTNCAEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVAARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IFT172.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26160
Iso type IgG

Enviar un mensaje


IFT172 polyclonal antibody

IFT172 polyclonal antibody