HPSE2 polyclonal antibody
  • HPSE2 polyclonal antibody

HPSE2 polyclonal antibody

Ref: AB-PAB24079
HPSE2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HPSE2.
Información adicional
Size 100 uL
Gene Name HPSE2
Gene Alias HPA2|HPR2|MGC133234
Gene Description heparanase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HPSE2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60495
Iso type IgG

Enviar un mensaje


HPSE2 polyclonal antibody

HPSE2 polyclonal antibody