C6orf132 polyclonal antibody
  • C6orf132 polyclonal antibody

C6orf132 polyclonal antibody

Ref: AB-PAB24076
C6orf132 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf132.
Información adicional
Size 100 uL
Gene Name C6orf132
Gene Alias FLJ90086|bA7K24.2
Gene Description chromosome 6 open reading frame 132
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QGTFSKLFGKKHTTTPSTSLYATNPPWIFTQEAPEEGTGGFDGIYYGDNRFNTVSESGTATLKARPRVRPLLTFLPLNAQEN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf132.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 647024
Iso type IgG

Enviar un mensaje


C6orf132 polyclonal antibody

C6orf132 polyclonal antibody