GPR113 polyclonal antibody
  • GPR113 polyclonal antibody

GPR113 polyclonal antibody

Ref: AB-PAB24067
GPR113 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR113.
Información adicional
Size 100 uL
Gene Name GPR113
Gene Alias FLJ16767|PGR23|hGPCR37
Gene Description G protein-coupled receptor 113
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CIPSTNLAYTAAWSPGEGSKASSFNESGSQCFVLAVQRCPMADTTYACDLQSLGLAPLRVPISITIIQDGDITCPEDASVLTWNVTKAGHVAQAPCPESKRGIVRRLCGADG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR113.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 165082
Iso type IgG

Enviar un mensaje


GPR113 polyclonal antibody

GPR113 polyclonal antibody