INCA1 polyclonal antibody
  • INCA1 polyclonal antibody

INCA1 polyclonal antibody

Ref: AB-PAB24064
INCA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INCA1.
Información adicional
Size 100 uL
Gene Name INCA1
Gene Alias HSD45|MGC148150|MGC148151
Gene Description inhibitor of CDK interacting with cyclin A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INCA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388324
Iso type IgG

Enviar un mensaje


INCA1 polyclonal antibody

INCA1 polyclonal antibody