THOC7 polyclonal antibody
  • THOC7 polyclonal antibody

THOC7 polyclonal antibody

Ref: AB-PAB24062
THOC7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THOC7.
Información adicional
Size 100 uL
Gene Name THOC7
Gene Alias FLJ23445|NIF3L1BP1|fSAP24
Gene Description THO complex 7 homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THOC7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80145
Iso type IgG

Enviar un mensaje


THOC7 polyclonal antibody

THOC7 polyclonal antibody