CAMSAP3 polyclonal antibody
  • CAMSAP3 polyclonal antibody

CAMSAP3 polyclonal antibody

Ref: AB-PAB24059
CAMSAP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CAMSAP3.
Información adicional
Size 100 uL
Gene Name CAMSAP3
Gene Alias KIAA1543|NEZHA
Gene Description calmodulin regulated spectrin-associated protein family, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRHQPILMGAHLAVIDALMAAFAFEWTKTLPGPLALTSLEHKLLFWVDTTVRRLQEKTEQEAAQRASPAAPADGAAPAQPSIRYRKDR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CAMSAP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57662
Iso type IgG

Enviar un mensaje


CAMSAP3 polyclonal antibody

CAMSAP3 polyclonal antibody