CRTC3 polyclonal antibody
  • CRTC3 polyclonal antibody

CRTC3 polyclonal antibody

Ref: AB-PAB24056
CRTC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CRTC3.
Información adicional
Size 100 uL
Gene Name CRTC3
Gene Alias FLJ21868|TORC3
Gene Description CREB regulated transcription coactivator 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CRTC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64784
Iso type IgG

Enviar un mensaje


CRTC3 polyclonal antibody

CRTC3 polyclonal antibody