TMEM44 polyclonal antibody
  • TMEM44 polyclonal antibody

TMEM44 polyclonal antibody

Ref: AB-PAB24055
TMEM44 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM44.
Información adicional
Size 100 uL
Gene Name TMEM44
Gene Alias DKFZp686O18124|MGC131692|MGC163169
Gene Description transmembrane protein 44
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DTQALLTCAEKEEENQENLDWVPLTTLSHCKSLRTMTAISRYMELTIEPVQQAGCSATRLPGDGQTSAGDASLQDPPSYPPVQVIRA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM44.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93109
Iso type IgG

Enviar un mensaje


TMEM44 polyclonal antibody

TMEM44 polyclonal antibody