ZNF320 polyclonal antibody
  • ZNF320 polyclonal antibody

ZNF320 polyclonal antibody

Ref: AB-PAB24052
ZNF320 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF320.
Información adicional
Size 100 uL
Gene Name ZNF320
Gene Alias DKFZp686G16228|ZFPL
Gene Description zinc finger protein 320
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF320.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 162967
Iso type IgG

Enviar un mensaje


ZNF320 polyclonal antibody

ZNF320 polyclonal antibody