PLAC9 polyclonal antibody
  • PLAC9 polyclonal antibody

PLAC9 polyclonal antibody

Ref: AB-PAB24042
PLAC9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLAC9.
Información adicional
Size 100 uL
Gene Name PLAC9
Gene Alias MGC104710
Gene Description placenta-specific 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLAC9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219348
Iso type IgG

Enviar un mensaje


PLAC9 polyclonal antibody

PLAC9 polyclonal antibody