C4orf22 polyclonal antibody
  • C4orf22 polyclonal antibody

C4orf22 polyclonal antibody

Ref: AB-PAB24037
C4orf22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C4orf22.
Información adicional
Size 100 uL
Gene Name C4orf22
Gene Alias MGC35043
Gene Description chromosome 4 open reading frame 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq QEEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLTSAGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C4orf22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 255119
Iso type IgG

Enviar un mensaje


C4orf22 polyclonal antibody

C4orf22 polyclonal antibody