CMC1 polyclonal antibody
  • CMC1 polyclonal antibody

CMC1 polyclonal antibody

Ref: AB-PAB24032
CMC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CMC1.
Información adicional
Size 100 uL
Gene Name CMC1
Gene Alias C3orf68|DKFZp779D0833|MGC61571
Gene Description COX assembly mitochondrial protein homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CMC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 152100
Iso type IgG

Enviar un mensaje


CMC1 polyclonal antibody

CMC1 polyclonal antibody