ANKRD34B polyclonal antibody
  • ANKRD34B polyclonal antibody

ANKRD34B polyclonal antibody

Ref: AB-PAB24030
ANKRD34B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD34B.
Información adicional
Size 100 uL
Gene Name ANKRD34B
Gene Alias DP58
Gene Description ankyrin repeat domain 34B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLERRGSGAFPLDHSVTQTR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD34B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340120
Iso type IgG

Enviar un mensaje


ANKRD34B polyclonal antibody

ANKRD34B polyclonal antibody