ALMS1 polyclonal antibody
  • ALMS1 polyclonal antibody

ALMS1 polyclonal antibody

Ref: AB-PAB24022
ALMS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALMS1.
Información adicional
Size 100 uL
Gene Name ALMS1
Gene Alias ALSS|DKFZp686A118|DKFZp686D1828|KIAA0328
Gene Description Alstrom syndrome 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ALMS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7840
Iso type IgG

Enviar un mensaje


ALMS1 polyclonal antibody

ALMS1 polyclonal antibody