PRDM12 polyclonal antibody
  • PRDM12 polyclonal antibody

PRDM12 polyclonal antibody

Ref: AB-PAB24014
PRDM12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRDM12.
Información adicional
Size 100 uL
Gene Name PRDM12
Gene Alias PFM9
Gene Description PR domain containing 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRDM12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 59335
Iso type IgG

Enviar un mensaje


PRDM12 polyclonal antibody

PRDM12 polyclonal antibody