TMUB2 polyclonal antibody
  • TMUB2 polyclonal antibody

TMUB2 polyclonal antibody

Ref: AB-PAB24013
TMUB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMUB2.
Información adicional
Size 100 uL
Gene Name TMUB2
Gene Alias FP2653|MGC3123
Gene Description transmembrane and ubiquitin-like domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMUB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79089
Iso type IgG

Enviar un mensaje


TMUB2 polyclonal antibody

TMUB2 polyclonal antibody