FILIP1L polyclonal antibody
  • FILIP1L polyclonal antibody

FILIP1L polyclonal antibody

Ref: AB-PAB24011
FILIP1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FILIP1L.
Información adicional
Size 100 uL
Gene Name FILIP1L
Gene Alias DOC-1|DOC1|GIP90
Gene Description filamin A interacting protein 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DNEPPDYKSLIPLERAVINGQLYEESENQDEDPNDEGSVLSFKCSQSTPCPVNRKLWIPWMKSKEGHLQNGKMQTKPNANFVQPGDLVLSHTPGQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FILIP1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11259
Iso type IgG

Enviar un mensaje


FILIP1L polyclonal antibody

FILIP1L polyclonal antibody