CCDC85A polyclonal antibody
  • CCDC85A polyclonal antibody

CCDC85A polyclonal antibody

Ref: AB-PAB24008
CCDC85A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC85A.
Información adicional
Size 100 uL
Gene Name CCDC85A
Gene Alias KIAA1912
Gene Description coiled-coil domain containing 85A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RHPHPGSSPETLPKHVLSGSPEHFQKHRSGSSPEHARHSGGSPEHLQKHALGGSLEHLPRARGTSPEHLKQHYGGSPDHKHGGGSGGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC85A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114800
Iso type IgG

Enviar un mensaje


CCDC85A polyclonal antibody

CCDC85A polyclonal antibody