DMRTA2 polyclonal antibody
  • DMRTA2 polyclonal antibody

DMRTA2 polyclonal antibody

Ref: AB-PAB24007
DMRTA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DMRTA2.
Información adicional
Size 100 uL
Gene Name DMRTA2
Gene Alias -
Gene Description DMRT-like family A2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GSEAKLQKFDLFPKTLLQAGRPGSPLPPPVKPLSPDGADSGPGTSSPEVRPGSGSENGDGESF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DMRTA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63950
Iso type IgG

Enviar un mensaje


DMRTA2 polyclonal antibody

DMRTA2 polyclonal antibody