DEFB125 polyclonal antibody
  • DEFB125 polyclonal antibody

DEFB125 polyclonal antibody

Ref: AB-PAB24006
DEFB125 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DEFB125.
Información adicional
Size 100 uL
Gene Name DEFB125
Gene Alias DEFB-25|MGC57449
Gene Description defensin, beta 125
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DEFB125.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 245938
Iso type IgG

Enviar un mensaje


DEFB125 polyclonal antibody

DEFB125 polyclonal antibody