DEFB119 polyclonal antibody
  • DEFB119 polyclonal antibody

DEFB119 polyclonal antibody

Ref: AB-PAB24003
DEFB119 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DEFB119.
Información adicional
Size 100 uL
Gene Name DEFB119
Gene Alias DEFB-19|DEFB-20|DEFB120|ESC42-RELA|ESC42-RELB|MGC71893
Gene Description defensin, beta 119
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DEFB119.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 245932
Iso type IgG

Enviar un mensaje


DEFB119 polyclonal antibody

DEFB119 polyclonal antibody