DBNDD1 polyclonal antibody
  • DBNDD1 polyclonal antibody

DBNDD1 polyclonal antibody

Ref: AB-PAB24000
DBNDD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DBNDD1.
Información adicional
Size 100 uL
Gene Name DBNDD1
Gene Alias FLJ12582|MGC3101
Gene Description dysbindin (dystrobrevin binding protein 1) domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DBNDD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79007
Iso type IgG

Enviar un mensaje


DBNDD1 polyclonal antibody

DBNDD1 polyclonal antibody