OR2AE1 polyclonal antibody
  • OR2AE1 polyclonal antibody

OR2AE1 polyclonal antibody

Ref: AB-PAB23997
OR2AE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OR2AE1.
Información adicional
Size 100 uL
Gene Name OR2AE1
Gene Alias OR2AE2
Gene Description olfactory receptor, family 2, subfamily AE, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MHFPFCGPRKVYHFYCEFPAVVKLVCGDITVYETTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OR2AE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81392
Iso type IgG

Enviar un mensaje


OR2AE1 polyclonal antibody

OR2AE1 polyclonal antibody