EPB41L4B polyclonal antibody
  • EPB41L4B polyclonal antibody

EPB41L4B polyclonal antibody

Ref: AB-PAB23993
EPB41L4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EPB41L4B.
Información adicional
Size 100 uL
Gene Name EPB41L4B
Gene Alias CG1|DKFZp761N1814|EHM2|FLJ21596
Gene Description erythrocyte membrane protein band 4.1 like 4B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EPB41L4B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54566
Iso type IgG

Enviar un mensaje


EPB41L4B polyclonal antibody

EPB41L4B polyclonal antibody