C3orf26 polyclonal antibody
  • C3orf26 polyclonal antibody

C3orf26 polyclonal antibody

Ref: AB-PAB23991
C3orf26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C3orf26.
Información adicional
Size 100 uL
Gene Name C3orf26
Gene Alias MGC4308
Gene Description chromosome 3 open reading frame 26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C3orf26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84319
Iso type IgG

Enviar un mensaje


C3orf26 polyclonal antibody

C3orf26 polyclonal antibody