FAM131A polyclonal antibody
  • FAM131A polyclonal antibody

FAM131A polyclonal antibody

Ref: AB-PAB23985
FAM131A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM131A.
Información adicional
Size 100 uL
Gene Name FAM131A
Gene Alias C3orf40|FLAT715|MGC21688|PRO1378
Gene Description family with sequence similarity 131, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM131A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 131408
Iso type IgG

Enviar un mensaje


FAM131A polyclonal antibody

FAM131A polyclonal antibody