FAM53C polyclonal antibody
  • FAM53C polyclonal antibody

FAM53C polyclonal antibody

Ref: AB-PAB23984
FAM53C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM53C.
Información adicional
Size 100 uL
Gene Name FAM53C
Gene Alias C5orf6
Gene Description family with sequence similarity 53, member C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq WRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDPRRLRPSLDFDKMNQKPYSGGLCLQETAREGSSISPPWFMACSPPPLSASCSPTGGSSQVLSESEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM53C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51307
Iso type IgG

Enviar un mensaje


FAM53C polyclonal antibody

FAM53C polyclonal antibody