FNIP2 polyclonal antibody
  • FNIP2 polyclonal antibody

FNIP2 polyclonal antibody

Ref: AB-PAB23979
FNIP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FNIP2.
Información adicional
Size 100 uL
Gene Name FNIP2
Gene Alias FNIPL|KIAA1450
Gene Description folliculin interacting protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FNIP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57600
Iso type IgG

Enviar un mensaje


FNIP2 polyclonal antibody

FNIP2 polyclonal antibody