NDUFB9 polyclonal antibody
  • NDUFB9 polyclonal antibody

NDUFB9 polyclonal antibody

Ref: AB-PAB23976
NDUFB9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NDUFB9.
Información adicional
Size 100 uL
Gene Name NDUFB9
Gene Alias B22|DKFZp566O173|FLJ22885|LYRM3|UQOR22
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NDUFB9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4715
Iso type IgG

Enviar un mensaje


NDUFB9 polyclonal antibody

NDUFB9 polyclonal antibody