ARHGEF18 polyclonal antibody
  • ARHGEF18 polyclonal antibody

ARHGEF18 polyclonal antibody

Ref: AB-PAB23969
ARHGEF18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGEF18.
Información adicional
Size 100 uL
Gene Name ARHGEF18
Gene Alias KIAA0521|MGC15913|P114-RhoGEF
Gene Description rho/rac guanine nucleotide exchange factor (GEF) 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGEF18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23370
Iso type IgG

Enviar un mensaje


ARHGEF18 polyclonal antibody

ARHGEF18 polyclonal antibody