C19orf6 polyclonal antibody
  • C19orf6 polyclonal antibody

C19orf6 polyclonal antibody

Ref: AB-PAB23965
C19orf6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf6.
Información adicional
Size 100 uL
Gene Name C19orf6
Gene Alias ASBABP1|MBRL|MEMBRALIN|MGC4022|R32184_3
Gene Description chromosome 19 open reading frame 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IKFELDIEPKVFKPPSSTEALNDSQEFPFPETPTKVWPQDEYIVEYSLEYGFLRLSQATRQRLSIPVMVVTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91304
Iso type IgG

Enviar un mensaje


C19orf6 polyclonal antibody

C19orf6 polyclonal antibody