DEFB118 polyclonal antibody
  • DEFB118 polyclonal antibody

DEFB118 polyclonal antibody

Ref: AB-PAB23961
DEFB118 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DEFB118.
Información adicional
Size 100 uL
Gene Name DEFB118
Gene Alias C20orf63|DEFB-18|ESC42|dJ1018D12.3
Gene Description defensin, beta 118
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DEFB118.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 117285
Iso type IgG

Enviar un mensaje


DEFB118 polyclonal antibody

DEFB118 polyclonal antibody