MEMO1 polyclonal antibody
  • MEMO1 polyclonal antibody

MEMO1 polyclonal antibody

Ref: AB-PAB23958
MEMO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MEMO1.
Información adicional
Size 100 uL
Gene Name MEMO1
Gene Alias C2orf4|CGI-27|DKFZp434I0135|FLJ25031|MEMO|NS5ATP7
Gene Description mediator of cell motility 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MEMO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51072
Iso type IgG

Enviar un mensaje


MEMO1 polyclonal antibody

MEMO1 polyclonal antibody