ENHO polyclonal antibody
  • ENHO polyclonal antibody

ENHO polyclonal antibody

Ref: AB-PAB23956
ENHO polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ENHO.
Información adicional
Size 100 uL
Gene Name ENHO
Gene Alias C9orf165|UNQ470
Gene Description energy homeostasis associated
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ENHO.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375704
Iso type IgG

Enviar un mensaje


ENHO polyclonal antibody

ENHO polyclonal antibody