CCDC114 polyclonal antibody
  • CCDC114 polyclonal antibody

CCDC114 polyclonal antibody

Ref: AB-PAB23951
CCDC114 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC114.
Información adicional
Size 100 uL
Gene Name CCDC114
Gene Alias FLJ32926
Gene Description coiled-coil domain containing 114
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKDDQHLLQEQQQKVLQQRMDKVHSEAERLEARFQDVRGQLEKLKADIQLLFTKAHCDSSMIDDLLGVKTSMGDRDMGLFLSLIEKRLVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC114.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93233
Iso type IgG

Enviar un mensaje


CCDC114 polyclonal antibody

CCDC114 polyclonal antibody