SETD2 polyclonal antibody
  • SETD2 polyclonal antibody

SETD2 polyclonal antibody

Ref: AB-PAB23943
SETD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SETD2.
Información adicional
Size 100 uL
Gene Name SETD2
Gene Alias FLJ16420|FLJ22472|FLJ23184|FLJ45883|FLJ46217|HIF-1|HSPC069|HYPB|KIAA1732|KMT3A|SET2|p231HBP
Gene Description SET domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SETD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29072
Iso type IgG

Enviar un mensaje


SETD2 polyclonal antibody

SETD2 polyclonal antibody