PLP2 polyclonal antibody
  • PLP2 polyclonal antibody

PLP2 polyclonal antibody

Ref: AB-PAB23941
PLP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLP2.
Información adicional
Size 100 uL
Gene Name PLP2
Gene Alias A4|A4-LSB|MGC126187
Gene Description proteolipid protein 2 (colonic epithelium-enriched)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RGNHSKIVAGVKAMGAALKHRAKGLRSQGPFLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5355
Iso type IgG

Enviar un mensaje


PLP2 polyclonal antibody

PLP2 polyclonal antibody