SCD5 polyclonal antibody
  • SCD5 polyclonal antibody

SCD5 polyclonal antibody

Ref: AB-PAB23935
SCD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCD5.
Información adicional
Size 100 uL
Gene Name SCD5
Gene Alias ACOD4|FADS4|FLJ21032|HSCD5|SCD2|SCD4
Gene Description stearoyl-CoA desaturase 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NTQHIQKEGRALNQEAACEMLREWHQGHILKVTLPGLHILALLHTHCNHSEKCCLMLRALSVSLEVF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79966
Iso type IgG

Enviar un mensaje


SCD5 polyclonal antibody

SCD5 polyclonal antibody